PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g48886.1.p
Common NameBRADI_3g48886, LOC100839418
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 269aa    MW: 30004.3 Da    PI: 4.8691
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g48886.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT++Ed+ll+++v+q G g+W+++a+  g++R++k+c++rw +yl
  Bradi3g48886.1.p 15 KGPWTAQEDKLLLEYVRQQGDGRWNSVAKVTGLKRSGKSCRLRWVNYL 62
                      79********************************************97 PP

2Myb_DNA-binding48.52e-1568112147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+ T++E+  +++++ ++G++ W+tIar ++ gRt++++k++w+++
  Bradi3g48886.1.p  68 RGKITPQEERVILELHGLWGNR-WSTIARSLP-GRTDNEIKNYWRTH 112
                       8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.1241062IPR017930Myb domain
SuperFamilySSF466891.5E-2913109IPR009057Homeodomain-like
SMARTSM007172.0E-151464IPR001005SANT/Myb domain
PfamPF002495.9E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-241669IPR009057Homeodomain-like
CDDcd001673.52E-111762No hitNo description
PROSITE profilePS5129425.04263117IPR017930Myb domain
SMARTSM007171.2E-1467115IPR001005SANT/Myb domain
PfamPF002493.0E-1368112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2370115IPR009057Homeodomain-like
CDDcd001671.69E-972113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MEQFGWGREE GGWRKGPWTA QEDKLLLEYV RQQGDGRWNS VAKVTGLKRS GKSCRLRWVN  60
YLRPDLKRGK ITPQEERVIL ELHGLWGNRW STIARSLPGR TDNEIKNYWR THFKKGKPTS  120
KNIERARARF LKQRREIMEG YPRGQDDGED VAASVDNTGY AAAAAAVSHD ADEATVRPAA  180
PTQDEDMEVI MPDMDEFLQY HPMSAYFLQG CCVDGGTSAS ASDAGSSGEI DGGATWGSLW  240
NLDDDDVVLD DVDVVGACCW DSFGLAFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-27151157106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0992831e-145AK099283.1 Oryza sativa Japonica Group cDNA clone:J023132O17, full insert sequence.
GenBankAK1118071e-145AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572719.10.0PREDICTED: myb-related protein Zm38
TrEMBLA0A0Q3M7E70.0A0A0Q3M7E7_BRADI; Uncharacterized protein
STRINGMLOC_6786.11e-124(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.15e-65myb domain protein 79